feat: V2 microservices stack — backend services, gateway, JWT auth

Add full V2 architecture: identity, content, studio (.NET 10) and file,
render, notification, gateway (Go) services with vendored deps, plus DB
migrations, event/API contracts, and an init-db script.

Wire the Next.js frontend to the gateway: server-side JWT auth routes
(login/register/refresh/logout/me), gateway fetch helper, and session/
cookie/jwt helpers under src/lib.

Containerize the stack via docker-compose.v2.yml and per-service
Dockerfiles. Base images resolve through a Nexus mirror (Docker Hub) and
MCR directly; npm/NuGet pull from Nexus groups. Self-host fonts via
next/font/local to avoid Google Fonts (geo-blocked).

Add CI workflow and ignore .env.v2, *.stackdump, and .NET bin/obj.

Co-Authored-By: Claude Opus 4.7 <noreply@anthropic.com>
This commit is contained in:
soroush.asadi
2026-05-29 23:29:31 +03:30
parent 53ea78a00d
commit 90ac0b81d1
7636 changed files with 3707504 additions and 240 deletions
@@ -0,0 +1,24 @@
# Compiled Object files, Static and Dynamic libs (Shared Objects)
*.o
*.a
*.so
# Folders
_obj
_test
# Architecture specific extensions/prefixes
*.[568vq]
[568vq].out
*.cgo1.go
*.cgo2.c
_cgo_defun.c
_cgo_gotypes.go
_cgo_export.*
_testmain.go
*.exe
*.test
*.prof
+74
View File
@@ -0,0 +1,74 @@
# This is an example goreleaser.yaml file with some sane defaults.
# Make sure to check the documentation at http://goreleaser.com
builds:
-
id: "cpuid"
binary: cpuid
main: ./cmd/cpuid/main.go
env:
- CGO_ENABLED=0
flags:
- -ldflags=-s -w
goos:
- aix
- linux
- freebsd
- netbsd
- windows
- darwin
goarch:
- 386
- amd64
- arm64
goarm:
- 7
archives:
-
id: cpuid
name_template: "cpuid-{{ .Os }}_{{ .Arch }}_{{ .Version }}"
replacements:
aix: AIX
darwin: OSX
linux: Linux
windows: Windows
386: i386
amd64: x86_64
freebsd: FreeBSD
netbsd: NetBSD
format_overrides:
- goos: windows
format: zip
files:
- LICENSE
checksum:
name_template: 'checksums.txt'
snapshot:
name_template: "{{ .Tag }}-next"
changelog:
sort: asc
filters:
exclude:
- '^doc:'
- '^docs:'
- '^test:'
- '^tests:'
- '^Update\sREADME.md'
nfpms:
-
file_name_template: "cpuid_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}"
vendor: Klaus Post
homepage: https://github.com/klauspost/cpuid
maintainer: Klaus Post <klauspost@gmail.com>
description: CPUID Tool
license: BSD 3-Clause
formats:
- deb
- rpm
replacements:
darwin: Darwin
linux: Linux
freebsd: FreeBSD
amd64: x86_64
+35
View File
@@ -0,0 +1,35 @@
Developer Certificate of Origin
Version 1.1
Copyright (C) 2015- Klaus Post & Contributors.
Email: klauspost@gmail.com
Everyone is permitted to copy and distribute verbatim copies of this
license document, but changing it is not allowed.
Developer's Certificate of Origin 1.1
By making a contribution to this project, I certify that:
(a) The contribution was created in whole or in part by me and I
have the right to submit it under the open source license
indicated in the file; or
(b) The contribution is based upon previous work that, to the best
of my knowledge, is covered under an appropriate open source
license and I have the right under that license to submit that
work with modifications, whether created in whole or in part
by me, under the same open source license (unless I am
permitted to submit under a different license), as indicated
in the file; or
(c) The contribution was provided directly to me by some other
person who certified (a), (b) or (c) and I have not modified
it.
(d) I understand and agree that this project and the contribution
are public and that a record of the contribution (including all
personal information I submit with it, including my sign-off) is
maintained indefinitely and may be redistributed consistent with
this project or the open source license(s) involved.
+22
View File
@@ -0,0 +1,22 @@
The MIT License (MIT)
Copyright (c) 2015 Klaus Post
Permission is hereby granted, free of charge, to any person obtaining a copy
of this software and associated documentation files (the "Software"), to deal
in the Software without restriction, including without limitation the rights
to use, copy, modify, merge, publish, distribute, sublicense, and/or sell
copies of the Software, and to permit persons to whom the Software is
furnished to do so, subject to the following conditions:
The above copyright notice and this permission notice shall be included in all
copies or substantial portions of the Software.
THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR
IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY,
FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE
AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER
LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM,
OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE
SOFTWARE.
+499
View File
@@ -0,0 +1,499 @@
# cpuid
Package cpuid provides information about the CPU running the current program.
CPU features are detected on startup, and kept for fast access through the life of the application.
Currently x86 / x64 (AMD64/i386) and ARM (ARM64) is supported, and no external C (cgo) code is used, which should make the library very easy to use.
You can access the CPU information by accessing the shared CPU variable of the cpuid library.
Package home: https://github.com/klauspost/cpuid
[![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2)
[![Go](https://github.com/klauspost/cpuid/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/cpuid/actions/workflows/go.yml)
## installing
`go get -u github.com/klauspost/cpuid/v2` using modules.
Drop `v2` for others.
Installing binary:
`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
Or download binaries from release page: https://github.com/klauspost/cpuid/releases
### Homebrew
For macOS/Linux users, you can install via [brew](https://brew.sh/)
```sh
$ brew install cpuid
```
## example
```Go
package main
import (
"fmt"
"strings"
. "github.com/klauspost/cpuid/v2"
)
func main() {
// Print basic CPU information:
fmt.Println("Name:", CPU.BrandName)
fmt.Println("PhysicalCores:", CPU.PhysicalCores)
fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore)
fmt.Println("LogicalCores:", CPU.LogicalCores)
fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID)
fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ","))
fmt.Println("Cacheline bytes:", CPU.CacheLine)
fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes")
fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes")
fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes")
fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes")
fmt.Println("Frequency", CPU.Hz, "hz")
// Test if we have these specific features:
if CPU.Supports(SSE, SSE2) {
fmt.Println("We have Streaming SIMD 2 Extensions")
}
}
```
Sample output:
```
>go run main.go
Name: AMD Ryzen 9 3950X 16-Core Processor
PhysicalCores: 16
ThreadsPerCore: 2
LogicalCores: 32
Family 23 Model: 113 Vendor ID: AMD
Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CMOV,CX16,F16C,FMA3,HTT,HYPERVISOR,LZCNT,MMX,MMXEXT,NX,POPCNT,RDRAND,RDSEED,RDTSCP,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3
Cacheline bytes: 64
L1 Data Cache: 32768 bytes
L1 Instruction Cache: 32768 bytes
L2 Cache: 524288 bytes
L3 Cache: 16777216 bytes
Frequency 0 hz
We have Streaming SIMD 2 Extensions
```
# usage
The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features.
A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler.
To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc.
This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported.
Note that for some cpu/os combinations some features will not be detected.
`amd64` has rather good support and should work reliably on all platforms.
Note that hypervisors may not pass through all CPU features through to the guest OS,
so even if your host supports a feature it may not be visible on guests.
## arm64 feature detection
Not all operating systems provide ARM features directly
and there is no safe way to do so for the rest.
Currently `arm64/linux` and `arm64/freebsd` should be quite reliable.
`arm64/darwin` adds features expected from the M1 processor, but a lot remains undetected.
A `DetectARM()` can be used if you are able to control your deployment,
it will detect CPU features, but may crash if the OS doesn't intercept the calls.
A `-cpu.arm` flag for detecting unsafe ARM features can be added. See below.
Note that currently only features are detected on ARM,
no additional information is currently available.
## flags
It is possible to add flags that affects cpu detection.
For this the `Flags()` command is provided.
This must be called *before* `flag.Parse()` AND after the flags have been parsed `Detect()` must be called.
This means that any detection used in `init()` functions will not contain these flags.
Example:
```Go
package main
import (
"flag"
"fmt"
"strings"
"github.com/klauspost/cpuid/v2"
)
func main() {
cpuid.Flags()
flag.Parse()
cpuid.Detect()
// Test if we have these specific features:
if cpuid.CPU.Supports(cpuid.SSE, cpuid.SSE2) {
fmt.Println("We have Streaming SIMD 2 Extensions")
}
}
```
## commandline
Download as binary from: https://github.com/klauspost/cpuid/releases
Install from source:
`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest`
### Example
```
λ cpuid
Name: AMD Ryzen 9 3950X 16-Core Processor
Vendor String: AuthenticAMD
Vendor ID: AMD
PhysicalCores: 16
Threads Per Core: 2
Logical Cores: 32
CPU Family 23 Model: 113
Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE
Microarchitecture level: 3
Cacheline bytes: 64
L1 Instruction Cache: 32768 bytes
L1 Data Cache: 32768 bytes
L2 Cache: 524288 bytes
L3 Cache: 16777216 bytes
```
### JSON Output:
```
λ cpuid --json
{
"BrandName": "AMD Ryzen 9 3950X 16-Core Processor",
"VendorID": 2,
"VendorString": "AuthenticAMD",
"PhysicalCores": 16,
"ThreadsPerCore": 2,
"LogicalCores": 32,
"Family": 23,
"Model": 113,
"CacheLine": 64,
"Hz": 0,
"BoostFreq": 0,
"Cache": {
"L1I": 32768,
"L1D": 32768,
"L2": 524288,
"L3": 16777216
},
"SGX": {
"Available": false,
"LaunchControl": false,
"SGX1Supported": false,
"SGX2Supported": false,
"MaxEnclaveSizeNot64": 0,
"MaxEnclaveSize64": 0,
"EPCSections": null
},
"Features": [
"ADX",
"AESNI",
"AVX",
"AVX2",
"BMI1",
"BMI2",
"CLMUL",
"CLZERO",
"CMOV",
"CMPXCHG8",
"CPBOOST",
"CX16",
"F16C",
"FMA3",
"FXSR",
"FXSROPT",
"HTT",
"HYPERVISOR",
"LAHF",
"LZCNT",
"MCAOVERFLOW",
"MMX",
"MMXEXT",
"MOVBE",
"NX",
"OSXSAVE",
"POPCNT",
"RDRAND",
"RDSEED",
"RDTSCP",
"SCE",
"SHA",
"SSE",
"SSE2",
"SSE3",
"SSE4",
"SSE42",
"SSE4A",
"SSSE3",
"SUCCOR",
"X87",
"XSAVE"
],
"X64Level": 3
}
```
### Check CPU microarch level
```
λ cpuid --check-level=3
2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor
2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3.
Exit Code 0
λ cpuid --check-level=4
2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor
2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3.
Exit Code 1
```
## Available flags
### x86 & amd64
| Feature Flag | Description |
|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------|
| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) |
| AESNI | Advanced Encryption Standard New Instructions |
| AMD3DNOW | AMD 3DNOW |
| AMD3DNOWEXT | AMD 3DNowExt |
| AMXBF16 | Tile computational operations on BFLOAT16 numbers |
| AMXINT8 | Tile computational operations on 8-bit integers |
| AMXFP16 | Tile computational operations on FP16 numbers |
| AMXFP8 | Tile computational operations on FP8 numbers |
| AMXTILE | Tile architecture |
| APX_F | Intel APX |
| AVX | AVX functions |
| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported |
| AVX10_128 | If set indicates that AVX10 128-bit vector support is present |
| AVX10_256 | If set indicates that AVX10 256-bit vector support is present |
| AVX10_512 | If set indicates that AVX10 512-bit vector support is present |
| AVX2 | AVX2 functions |
| AVX512BF16 | AVX-512 BFLOAT16 Instructions |
| AVX512BITALG | AVX-512 Bit Algorithms |
| AVX512BW | AVX-512 Byte and Word Instructions |
| AVX512CD | AVX-512 Conflict Detection Instructions |
| AVX512DQ | AVX-512 Doubleword and Quadword Instructions |
| AVX512ER | AVX-512 Exponential and Reciprocal Instructions |
| AVX512F | AVX-512 Foundation |
| AVX512FP16 | AVX-512 FP16 Instructions |
| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions |
| AVX512PF | AVX-512 Prefetch Instructions |
| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions |
| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 |
| AVX512VL | AVX-512 Vector Length Extensions |
| AVX512VNNI | AVX-512 Vector Neural Network Instructions |
| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q |
| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword |
| AVXIFMA | AVX-IFMA instructions |
| AVXNECONVERT | AVX-NE-CONVERT instructions |
| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one |
| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions |
| AVXVNNIINT8 | AVX-VNNI-INT8 instructions |
| AVXVNNIINT16 | AVX-VNNI-INT16 instructions |
| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 |
| BMI1 | Bit Manipulation Instruction Set 1 |
| BMI2 | Bit Manipulation Instruction Set 2 |
| CETIBT | Intel CET Indirect Branch Tracking |
| CETSS | Intel CET Shadow Stack |
| CLDEMOTE | Cache Line Demote |
| CLMUL | Carry-less Multiplication |
| CLZERO | CLZERO instruction supported |
| CMOV | i686 CMOV |
| CMPCCXADD | CMPCCXADD instructions |
| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB |
| CMPXCHG8 | CMPXCHG8 instruction |
| CPBOOST | Core Performance Boost |
| CPPC | AMD: Collaborative Processor Performance Control |
| CX16 | CMPXCHG16B Instruction |
| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ |
| ENQCMD | Enqueue Command |
| ERMS | Enhanced REP MOVSB/STOSB |
| F16C | Half-precision floating-point conversion |
| FLUSH_L1D | Flush L1D cache |
| FMA3 | Intel FMA 3. Does not imply AVX. |
| FMA4 | Bulldozer FMA4 functions |
| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide |
| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide |
| FSRM | Fast Short Rep Mov |
| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 |
| FXSROPT | FXSAVE/FXRSTOR optimizations |
| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. |
| HLE | Hardware Lock Elision |
| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR |
| HTT | Hyperthreading (enabled) |
| HWA | Hardware assert supported. Indicates support for MSRC001_10 |
| HYBRID_CPU | This part has CPUs of more than one type. |
| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors |
| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) |
| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR |
| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) |
| IBRS | AMD: Indirect Branch Restricted Speculation |
| IBRS_PREFERRED | AMD: IBRS is preferred over software solution |
| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection |
| IBS | Instruction Based Sampling (AMD) |
| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) |
| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) |
| IBSFFV | Instruction Based Sampling Feature (AMD) |
| IBSOPCNT | Instruction Based Sampling Feature (AMD) |
| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) |
| IBSOPSAM | Instruction Based Sampling Feature (AMD) |
| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) |
| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) |
| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported |
| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported |
| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse |
| IBS_PREVENTHOST | Disallowing IBS use by the host supported |
| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 |
| IDPRED_CTRL | IPRED_DIS |
| INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
| INVLPGB | NVLPGB and TLBSYNC instruction supported |
| KEYLOCKER | Key locker |
| KEYLOCKERW | Key locker wide |
| LAHF | LAHF/SAHF in long mode |
| LAM | If set, CPU supports Linear Address Masking |
| LBRVIRT | LBR virtualization |
| LZCNT | LZCNT instruction |
| MCAOVERFLOW | MCA overflow recovery support. |
| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. |
| MCOMMIT | MCOMMIT instruction supported |
| MD_CLEAR | VERW clears CPU buffers |
| MMX | standard MMX |
| MMXEXT | SSE integer functions or AMD MMX ext |
| MOVBE | MOVBE instruction (big-endian) |
| MOVDIR64B | Move 64 Bytes as Direct Store |
| MOVDIRI | Move Doubleword as Direct Store |
| MOVSB_ZL | Fast Zero-Length MOVSB |
| MPX | Intel MPX (Memory Protection Extensions) |
| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
| MSRIRC | Instruction Retired Counter MSR available |
| MSRLIST | Read/Write List of Model Specific Registers |
| MSR_PAGEFLUSH | Page Flush MSR available |
| NRIPS | Indicates support for NRIP save on VMEXIT |
| NX | NX (No-Execute) bit |
| OSXSAVE | XSAVE enabled by OS |
| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption |
| POPCNT | POPCNT instruction |
| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled |
| PREFETCHI | PREFETCHIT0/1 instructions |
| PSFD | Predictive Store Forward Disable |
| RDPRU | RDPRU instruction supported |
| RDRAND | RDRAND instruction is available |
| RDSEED | RDSEED instruction is available |
| RDTSCP | RDTSCP Instruction |
| RRSBA_CTRL | Restricted RSB Alternate |
| RTM | Restricted Transactional Memory |
| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. |
| SERIALIZE | Serialize Instruction Execution |
| SEV | AMD Secure Encrypted Virtualization supported |
| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host |
| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported |
| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests |
| SEV_ES | AMD SEV Encrypted State supported |
| SEV_RESTRICTED | AMD SEV Restricted Injection supported |
| SEV_SNP | AMD SEV Secure Nested Paging supported |
| SGX | Software Guard Extensions |
| SGXLC | Software Guard Extensions Launch Control |
| SHA | Intel SHA Extensions |
| SME | AMD Secure Memory Encryption supported |
| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced |
| SPEC_CTRL_SSBD | Speculative Store Bypass Disable |
| SRBDS_CTRL | SRBDS mitigation MSR available |
| SSE | SSE functions |
| SSE2 | P4 SSE functions |
| SSE3 | Prescott SSE3 functions |
| SSE4 | Penryn SSE4.1 functions |
| SSE42 | Nehalem SSE4.2 functions |
| SSE4A | AMD Barcelona microarchitecture SSE4a instructions |
| SSSE3 | Conroe SSSE3 functions |
| STIBP | Single Thread Indirect Branch Predictors |
| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On |
| STOSB_SHORT | Fast short STOSB |
| SUCCOR | Software uncorrectable error containment and recovery capability. |
| SVM | AMD Secure Virtual Machine |
| SVMDA | Indicates support for the SVM decode assists. |
| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control |
| SVML | AMD SVM lock. Indicates support for SVM-Lock. |
| SVMNP | AMD SVM nested paging |
| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter |
| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold |
| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. |
| SYSEE | SYSENTER and SYSEXIT instructions |
| TBM | AMD Trailing Bit Manipulation |
| TDX_GUEST | Intel Trust Domain Extensions Guest |
| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations |
| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. |
| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. |
| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 |
| TSXLDTRK | Intel TSX Suspend Load Address Tracking |
| VAES | Vector AES. AVX(512) versions requires additional checks. |
| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. |
| VMPL | AMD VM Permission Levels supported |
| VMSA_REGPROT | AMD VMSA Register Protection supported |
| VMX | Virtual Machine Extensions |
| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. |
| VTE | AMD Virtual Transparent Encryption supported |
| WAITPKG | TPAUSE, UMONITOR, UMWAIT |
| WBNOINVD | Write Back and Do Not Invalidate Cache |
| WRMSRNS | Non-Serializing Write to Model Specific Register |
| X87 | FPU |
| XGETBV1 | Supports XGETBV with ECX = 1 |
| XOP | Bulldozer XOP functions |
| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV |
| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. |
| XSAVEOPT | XSAVEOPT available |
| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS |
# ARM features:
| Feature Flag | Description |
|--------------|------------------------------------------------------------------|
| AESARM | AES instructions |
| ARMCPUID | Some CPU ID registers readable at user-level |
| ASIMD | Advanced SIMD |
| ASIMDDP | SIMD Dot Product |
| ASIMDHP | Advanced SIMD half-precision floating point |
| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) |
| ATOMICS | Large System Extensions (LSE) |
| CRC32 | CRC32/CRC32C instructions |
| DCPOP | Data cache clean to Point of Persistence (DC CVAP) |
| EVTSTRM | Generic timer |
| FCMA | Floatin point complex number addition and multiplication |
| FP | Single-precision and double-precision floating point |
| FPHP | Half-precision floating point |
| GPA | Generic Pointer Authentication |
| JSCVT | Javascript-style double->int convert (FJCVTZS) |
| LRCPC | Weaker release consistency (LDAPR, etc) |
| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) |
| SHA1 | SHA-1 instructions (SHA1C, etc) |
| SHA2 | SHA-2 instructions (SHA256H, etc) |
| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) |
| SHA512 | SHA512 instructions |
| SM3 | SM3 instructions |
| SM4 | SM4 instructions |
| SVE | Scalable Vector Extension |
# license
This code is published under an MIT license. See LICENSE file for more information.
File diff suppressed because it is too large Load Diff
+47
View File
@@ -0,0 +1,47 @@
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
//+build 386,!gccgo,!noasm,!appengine
// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
TEXT ·asmCpuid(SB), 7, $0
XORL CX, CX
MOVL op+0(FP), AX
CPUID
MOVL AX, eax+4(FP)
MOVL BX, ebx+8(FP)
MOVL CX, ecx+12(FP)
MOVL DX, edx+16(FP)
RET
// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
TEXT ·asmCpuidex(SB), 7, $0
MOVL op+0(FP), AX
MOVL op2+4(FP), CX
CPUID
MOVL AX, eax+8(FP)
MOVL BX, ebx+12(FP)
MOVL CX, ecx+16(FP)
MOVL DX, edx+20(FP)
RET
// func xgetbv(index uint32) (eax, edx uint32)
TEXT ·asmXgetbv(SB), 7, $0
MOVL index+0(FP), CX
BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV
MOVL AX, eax+4(FP)
MOVL DX, edx+8(FP)
RET
// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
TEXT ·asmRdtscpAsm(SB), 7, $0
BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP
MOVL AX, eax+0(FP)
MOVL BX, ebx+4(FP)
MOVL CX, ecx+8(FP)
MOVL DX, edx+12(FP)
RET
// func asmDarwinHasAVX512() bool
TEXT ·asmDarwinHasAVX512(SB), 7, $0
MOVL $0, eax+0(FP)
RET
+72
View File
@@ -0,0 +1,72 @@
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
//+build amd64,!gccgo,!noasm,!appengine
// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
TEXT ·asmCpuid(SB), 7, $0
XORQ CX, CX
MOVL op+0(FP), AX
CPUID
MOVL AX, eax+8(FP)
MOVL BX, ebx+12(FP)
MOVL CX, ecx+16(FP)
MOVL DX, edx+20(FP)
RET
// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
TEXT ·asmCpuidex(SB), 7, $0
MOVL op+0(FP), AX
MOVL op2+4(FP), CX
CPUID
MOVL AX, eax+8(FP)
MOVL BX, ebx+12(FP)
MOVL CX, ecx+16(FP)
MOVL DX, edx+20(FP)
RET
// func asmXgetbv(index uint32) (eax, edx uint32)
TEXT ·asmXgetbv(SB), 7, $0
MOVL index+0(FP), CX
BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV
MOVL AX, eax+8(FP)
MOVL DX, edx+12(FP)
RET
// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
TEXT ·asmRdtscpAsm(SB), 7, $0
BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP
MOVL AX, eax+0(FP)
MOVL BX, ebx+4(FP)
MOVL CX, ecx+8(FP)
MOVL DX, edx+12(FP)
RET
// From https://go-review.googlesource.com/c/sys/+/285572/
// func asmDarwinHasAVX512() bool
TEXT ·asmDarwinHasAVX512(SB), 7, $0-1
MOVB $0, ret+0(FP) // default to false
#ifdef GOOS_darwin // return if not darwin
#ifdef GOARCH_amd64 // return if not amd64
// These values from:
// https://github.com/apple/darwin-xnu/blob/xnu-4570.1.46/osfmk/i386/cpu_capabilities.h
#define commpage64_base_address 0x00007fffffe00000
#define commpage64_cpu_capabilities64 (commpage64_base_address+0x010)
#define commpage64_version (commpage64_base_address+0x01E)
#define hasAVX512F 0x0000004000000000
MOVQ $commpage64_version, BX
MOVW (BX), AX
CMPW AX, $13 // versions < 13 do not support AVX512
JL no_avx512
MOVQ $commpage64_cpu_capabilities64, BX
MOVQ (BX), AX
MOVQ $hasAVX512F, CX
ANDQ CX, AX
JZ no_avx512
MOVB $1, ret+0(FP)
no_avx512:
#endif
#endif
RET
+36
View File
@@ -0,0 +1,36 @@
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
//+build arm64,!gccgo,!noasm,!appengine
// See https://www.kernel.org/doc/Documentation/arm64/cpu-feature-registers.txt
// func getMidr
TEXT ·getMidr(SB), 7, $0
WORD $0xd5380000 // mrs x0, midr_el1 /* Main ID Register */
MOVD R0, midr+0(FP)
RET
// func getProcFeatures
TEXT ·getProcFeatures(SB), 7, $0
WORD $0xd5380400 // mrs x0, id_aa64pfr0_el1 /* Processor Feature Register 0 */
MOVD R0, procFeatures+0(FP)
RET
// func getInstAttributes
TEXT ·getInstAttributes(SB), 7, $0
WORD $0xd5380600 // mrs x0, id_aa64isar0_el1 /* Instruction Set Attribute Register 0 */
WORD $0xd5380621 // mrs x1, id_aa64isar1_el1 /* Instruction Set Attribute Register 1 */
MOVD R0, instAttrReg0+0(FP)
MOVD R1, instAttrReg1+8(FP)
RET
TEXT ·getVectorLength(SB), 7, $0
WORD $0xd2800002 // mov x2, #0
WORD $0x04225022 // addvl x2, x2, #1
WORD $0xd37df042 // lsl x2, x2, #3
WORD $0xd2800003 // mov x3, #0
WORD $0x04635023 // addpl x3, x3, #1
WORD $0xd37df063 // lsl x3, x3, #3
MOVD R2, vl+0(FP)
MOVD R3, pl+8(FP)
RET
+248
View File
@@ -0,0 +1,248 @@
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
//go:build arm64 && !gccgo && !noasm && !appengine
// +build arm64,!gccgo,!noasm,!appengine
package cpuid
import "runtime"
func getMidr() (midr uint64)
func getProcFeatures() (procFeatures uint64)
func getInstAttributes() (instAttrReg0, instAttrReg1 uint64)
func getVectorLength() (vl, pl uint64)
func initCPU() {
cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
xgetbv = func(uint32) (a, b uint32) { return 0, 0 }
rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 }
}
func addInfo(c *CPUInfo, safe bool) {
// Seems to be safe to assume on ARM64
c.CacheLine = 64
detectOS(c)
// ARM64 disabled since it may crash if interrupt is not intercepted by OS.
if safe && !c.Has(ARMCPUID) && runtime.GOOS != "freebsd" {
return
}
midr := getMidr()
// MIDR_EL1 - Main ID Register
// https://developer.arm.com/docs/ddi0595/h/aarch64-system-registers/midr_el1
// x--------------------------------------------------x
// | Name | bits | visible |
// |--------------------------------------------------|
// | Implementer | [31-24] | y |
// |--------------------------------------------------|
// | Variant | [23-20] | y |
// |--------------------------------------------------|
// | Architecture | [19-16] | y |
// |--------------------------------------------------|
// | PartNum | [15-4] | y |
// |--------------------------------------------------|
// | Revision | [3-0] | y |
// x--------------------------------------------------x
switch (midr >> 24) & 0xff {
case 0xC0:
c.VendorString = "Ampere Computing"
c.VendorID = Ampere
case 0x41:
c.VendorString = "Arm Limited"
c.VendorID = ARM
case 0x42:
c.VendorString = "Broadcom Corporation"
c.VendorID = Broadcom
case 0x43:
c.VendorString = "Cavium Inc"
c.VendorID = Cavium
case 0x44:
c.VendorString = "Digital Equipment Corporation"
c.VendorID = DEC
case 0x46:
c.VendorString = "Fujitsu Ltd"
c.VendorID = Fujitsu
case 0x49:
c.VendorString = "Infineon Technologies AG"
c.VendorID = Infineon
case 0x4D:
c.VendorString = "Motorola or Freescale Semiconductor Inc"
c.VendorID = Motorola
case 0x4E:
c.VendorString = "NVIDIA Corporation"
c.VendorID = NVIDIA
case 0x50:
c.VendorString = "Applied Micro Circuits Corporation"
c.VendorID = AMCC
case 0x51:
c.VendorString = "Qualcomm Inc"
c.VendorID = Qualcomm
case 0x56:
c.VendorString = "Marvell International Ltd"
c.VendorID = Marvell
case 0x69:
c.VendorString = "Intel Corporation"
c.VendorID = Intel
}
// Lower 4 bits: Architecture
// Architecture Meaning
// 0b0001 Armv4.
// 0b0010 Armv4T.
// 0b0011 Armv5 (obsolete).
// 0b0100 Armv5T.
// 0b0101 Armv5TE.
// 0b0110 Armv5TEJ.
// 0b0111 Armv6.
// 0b1111 Architectural features are individually identified in the ID_* registers, see 'ID registers'.
// Upper 4 bit: Variant
// An IMPLEMENTATION DEFINED variant number.
// Typically, this field is used to distinguish between different product variants, or major revisions of a product.
c.Family = int(midr>>16) & 0xff
// PartNum, bits [15:4]
// An IMPLEMENTATION DEFINED primary part number for the device.
// On processors implemented by Arm, if the top four bits of the primary
// part number are 0x0 or 0x7, the variant and architecture are encoded differently.
// Revision, bits [3:0]
// An IMPLEMENTATION DEFINED revision number for the device.
c.Model = int(midr) & 0xffff
procFeatures := getProcFeatures()
// ID_AA64PFR0_EL1 - Processor Feature Register 0
// x--------------------------------------------------x
// | Name | bits | visible |
// |--------------------------------------------------|
// | DIT | [51-48] | y |
// |--------------------------------------------------|
// | SVE | [35-32] | y |
// |--------------------------------------------------|
// | GIC | [27-24] | n |
// |--------------------------------------------------|
// | AdvSIMD | [23-20] | y |
// |--------------------------------------------------|
// | FP | [19-16] | y |
// |--------------------------------------------------|
// | EL3 | [15-12] | n |
// |--------------------------------------------------|
// | EL2 | [11-8] | n |
// |--------------------------------------------------|
// | EL1 | [7-4] | n |
// |--------------------------------------------------|
// | EL0 | [3-0] | n |
// x--------------------------------------------------x
var f flagSet
// if procFeatures&(0xf<<48) != 0 {
// fmt.Println("DIT")
// }
f.setIf(procFeatures&(0xf<<32) != 0, SVE)
if procFeatures&(0xf<<20) != 15<<20 {
f.set(ASIMD)
// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64pfr0_el1
// 0b0001 --> As for 0b0000, and also includes support for half-precision floating-point arithmetic.
f.setIf(procFeatures&(0xf<<20) == 1<<20, FPHP, ASIMDHP)
}
f.setIf(procFeatures&(0xf<<16) != 0, FP)
instAttrReg0, instAttrReg1 := getInstAttributes()
// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1
//
// ID_AA64ISAR0_EL1 - Instruction Set Attribute Register 0
// x--------------------------------------------------x
// | Name | bits | visible |
// |--------------------------------------------------|
// | TS | [55-52] | y |
// |--------------------------------------------------|
// | FHM | [51-48] | y |
// |--------------------------------------------------|
// | DP | [47-44] | y |
// |--------------------------------------------------|
// | SM4 | [43-40] | y |
// |--------------------------------------------------|
// | SM3 | [39-36] | y |
// |--------------------------------------------------|
// | SHA3 | [35-32] | y |
// |--------------------------------------------------|
// | RDM | [31-28] | y |
// |--------------------------------------------------|
// | ATOMICS | [23-20] | y |
// |--------------------------------------------------|
// | CRC32 | [19-16] | y |
// |--------------------------------------------------|
// | SHA2 | [15-12] | y |
// |--------------------------------------------------|
// | SHA1 | [11-8] | y |
// |--------------------------------------------------|
// | AES | [7-4] | y |
// x--------------------------------------------------x
// if instAttrReg0&(0xf<<52) != 0 {
// fmt.Println("TS")
// }
// if instAttrReg0&(0xf<<48) != 0 {
// fmt.Println("FHM")
// }
f.setIf(instAttrReg0&(0xf<<44) != 0, ASIMDDP)
f.setIf(instAttrReg0&(0xf<<40) != 0, SM4)
f.setIf(instAttrReg0&(0xf<<36) != 0, SM3)
f.setIf(instAttrReg0&(0xf<<32) != 0, SHA3)
f.setIf(instAttrReg0&(0xf<<28) != 0, ASIMDRDM)
f.setIf(instAttrReg0&(0xf<<20) != 0, ATOMICS)
f.setIf(instAttrReg0&(0xf<<16) != 0, CRC32)
f.setIf(instAttrReg0&(0xf<<12) != 0, SHA2)
// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1
// 0b0010 --> As 0b0001, plus SHA512H, SHA512H2, SHA512SU0, and SHA512SU1 instructions implemented.
f.setIf(instAttrReg0&(0xf<<12) == 2<<12, SHA512)
f.setIf(instAttrReg0&(0xf<<8) != 0, SHA1)
f.setIf(instAttrReg0&(0xf<<4) != 0, AESARM)
// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1
// 0b0010 --> As for 0b0001, plus PMULL/PMULL2 instructions operating on 64-bit data quantities.
f.setIf(instAttrReg0&(0xf<<4) == 2<<4, PMULL)
// https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar1_el1
//
// ID_AA64ISAR1_EL1 - Instruction set attribute register 1
// x--------------------------------------------------x
// | Name | bits | visible |
// |--------------------------------------------------|
// | GPI | [31-28] | y |
// |--------------------------------------------------|
// | GPA | [27-24] | y |
// |--------------------------------------------------|
// | LRCPC | [23-20] | y |
// |--------------------------------------------------|
// | FCMA | [19-16] | y |
// |--------------------------------------------------|
// | JSCVT | [15-12] | y |
// |--------------------------------------------------|
// | API | [11-8] | y |
// |--------------------------------------------------|
// | APA | [7-4] | y |
// |--------------------------------------------------|
// | DPB | [3-0] | y |
// x--------------------------------------------------x
// if instAttrReg1&(0xf<<28) != 0 {
// fmt.Println("GPI")
// }
f.setIf(instAttrReg1&(0xf<<28) != 24, GPA)
f.setIf(instAttrReg1&(0xf<<20) != 0, LRCPC)
f.setIf(instAttrReg1&(0xf<<16) != 0, FCMA)
f.setIf(instAttrReg1&(0xf<<12) != 0, JSCVT)
// if instAttrReg1&(0xf<<8) != 0 {
// fmt.Println("API")
// }
// if instAttrReg1&(0xf<<4) != 0 {
// fmt.Println("APA")
// }
f.setIf(instAttrReg1&(0xf<<0) != 0, DCPOP)
// Store
c.featureSet.or(f)
}
+17
View File
@@ -0,0 +1,17 @@
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine
// +build !amd64,!386,!arm64 gccgo noasm appengine
package cpuid
func initCPU() {
cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 }
xgetbv = func(uint32) (a, b uint32) { return 0, 0 }
rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 }
}
func addInfo(info *CPUInfo, safe bool) {}
func getVectorLength() (vl, pl uint64) { return 0, 0 }
+41
View File
@@ -0,0 +1,41 @@
// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file.
//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine)
// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine
package cpuid
func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32)
func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32)
func asmXgetbv(index uint32) (eax, edx uint32)
func asmRdtscpAsm() (eax, ebx, ecx, edx uint32)
func asmDarwinHasAVX512() bool
func initCPU() {
cpuid = asmCpuid
cpuidex = asmCpuidex
xgetbv = asmXgetbv
rdtscpAsm = asmRdtscpAsm
darwinHasAVX512 = asmDarwinHasAVX512
}
func addInfo(c *CPUInfo, safe bool) {
c.maxFunc = maxFunctionID()
c.maxExFunc = maxExtendedFunction()
c.BrandName = brandName()
c.CacheLine = cacheLine()
c.Family, c.Model, c.Stepping = familyModel()
c.featureSet = support()
c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC))
c.AMDMemEncryption = hasAMDMemEncryption(c.featureSet.inSet(SME) || c.featureSet.inSet(SEV))
c.ThreadsPerCore = threadsPerCore()
c.LogicalCores = logicalCores()
c.PhysicalCores = physicalCores()
c.VendorID, c.VendorString = vendorID()
c.HypervisorVendorID, c.HypervisorVendorString = hypervisorVendorID()
c.AVX10Level = c.supportAVX10()
c.cacheSize()
c.frequencies()
}
func getVectorLength() (vl, pl uint64) { return 0, 0 }
+291
View File
@@ -0,0 +1,291 @@
// Code generated by "stringer -type=FeatureID,Vendor"; DO NOT EDIT.
package cpuid
import "strconv"
func _() {
// An "invalid array index" compiler error signifies that the constant values have changed.
// Re-run the stringer command to generate them again.
var x [1]struct{}
_ = x[ADX-1]
_ = x[AESNI-2]
_ = x[AMD3DNOW-3]
_ = x[AMD3DNOWEXT-4]
_ = x[AMXBF16-5]
_ = x[AMXFP16-6]
_ = x[AMXINT8-7]
_ = x[AMXFP8-8]
_ = x[AMXTILE-9]
_ = x[APX_F-10]
_ = x[AVX-11]
_ = x[AVX10-12]
_ = x[AVX10_128-13]
_ = x[AVX10_256-14]
_ = x[AVX10_512-15]
_ = x[AVX2-16]
_ = x[AVX512BF16-17]
_ = x[AVX512BITALG-18]
_ = x[AVX512BW-19]
_ = x[AVX512CD-20]
_ = x[AVX512DQ-21]
_ = x[AVX512ER-22]
_ = x[AVX512F-23]
_ = x[AVX512FP16-24]
_ = x[AVX512IFMA-25]
_ = x[AVX512PF-26]
_ = x[AVX512VBMI-27]
_ = x[AVX512VBMI2-28]
_ = x[AVX512VL-29]
_ = x[AVX512VNNI-30]
_ = x[AVX512VP2INTERSECT-31]
_ = x[AVX512VPOPCNTDQ-32]
_ = x[AVXIFMA-33]
_ = x[AVXNECONVERT-34]
_ = x[AVXSLOW-35]
_ = x[AVXVNNI-36]
_ = x[AVXVNNIINT8-37]
_ = x[AVXVNNIINT16-38]
_ = x[BHI_CTRL-39]
_ = x[BMI1-40]
_ = x[BMI2-41]
_ = x[CETIBT-42]
_ = x[CETSS-43]
_ = x[CLDEMOTE-44]
_ = x[CLMUL-45]
_ = x[CLZERO-46]
_ = x[CMOV-47]
_ = x[CMPCCXADD-48]
_ = x[CMPSB_SCADBS_SHORT-49]
_ = x[CMPXCHG8-50]
_ = x[CPBOOST-51]
_ = x[CPPC-52]
_ = x[CX16-53]
_ = x[EFER_LMSLE_UNS-54]
_ = x[ENQCMD-55]
_ = x[ERMS-56]
_ = x[F16C-57]
_ = x[FLUSH_L1D-58]
_ = x[FMA3-59]
_ = x[FMA4-60]
_ = x[FP128-61]
_ = x[FP256-62]
_ = x[FSRM-63]
_ = x[FXSR-64]
_ = x[FXSROPT-65]
_ = x[GFNI-66]
_ = x[HLE-67]
_ = x[HRESET-68]
_ = x[HTT-69]
_ = x[HWA-70]
_ = x[HYBRID_CPU-71]
_ = x[HYPERVISOR-72]
_ = x[IA32_ARCH_CAP-73]
_ = x[IA32_CORE_CAP-74]
_ = x[IBPB-75]
_ = x[IBPB_BRTYPE-76]
_ = x[IBRS-77]
_ = x[IBRS_PREFERRED-78]
_ = x[IBRS_PROVIDES_SMP-79]
_ = x[IBS-80]
_ = x[IBSBRNTRGT-81]
_ = x[IBSFETCHSAM-82]
_ = x[IBSFFV-83]
_ = x[IBSOPCNT-84]
_ = x[IBSOPCNTEXT-85]
_ = x[IBSOPSAM-86]
_ = x[IBSRDWROPCNT-87]
_ = x[IBSRIPINVALIDCHK-88]
_ = x[IBS_FETCH_CTLX-89]
_ = x[IBS_OPDATA4-90]
_ = x[IBS_OPFUSE-91]
_ = x[IBS_PREVENTHOST-92]
_ = x[IBS_ZEN4-93]
_ = x[IDPRED_CTRL-94]
_ = x[INT_WBINVD-95]
_ = x[INVLPGB-96]
_ = x[KEYLOCKER-97]
_ = x[KEYLOCKERW-98]
_ = x[LAHF-99]
_ = x[LAM-100]
_ = x[LBRVIRT-101]
_ = x[LZCNT-102]
_ = x[MCAOVERFLOW-103]
_ = x[MCDT_NO-104]
_ = x[MCOMMIT-105]
_ = x[MD_CLEAR-106]
_ = x[MMX-107]
_ = x[MMXEXT-108]
_ = x[MOVBE-109]
_ = x[MOVDIR64B-110]
_ = x[MOVDIRI-111]
_ = x[MOVSB_ZL-112]
_ = x[MOVU-113]
_ = x[MPX-114]
_ = x[MSRIRC-115]
_ = x[MSRLIST-116]
_ = x[MSR_PAGEFLUSH-117]
_ = x[NRIPS-118]
_ = x[NX-119]
_ = x[OSXSAVE-120]
_ = x[PCONFIG-121]
_ = x[POPCNT-122]
_ = x[PPIN-123]
_ = x[PREFETCHI-124]
_ = x[PSFD-125]
_ = x[RDPRU-126]
_ = x[RDRAND-127]
_ = x[RDSEED-128]
_ = x[RDTSCP-129]
_ = x[RRSBA_CTRL-130]
_ = x[RTM-131]
_ = x[RTM_ALWAYS_ABORT-132]
_ = x[SBPB-133]
_ = x[SERIALIZE-134]
_ = x[SEV-135]
_ = x[SEV_64BIT-136]
_ = x[SEV_ALTERNATIVE-137]
_ = x[SEV_DEBUGSWAP-138]
_ = x[SEV_ES-139]
_ = x[SEV_RESTRICTED-140]
_ = x[SEV_SNP-141]
_ = x[SGX-142]
_ = x[SGXLC-143]
_ = x[SHA-144]
_ = x[SME-145]
_ = x[SME_COHERENT-146]
_ = x[SPEC_CTRL_SSBD-147]
_ = x[SRBDS_CTRL-148]
_ = x[SRSO_MSR_FIX-149]
_ = x[SRSO_NO-150]
_ = x[SRSO_USER_KERNEL_NO-151]
_ = x[SSE-152]
_ = x[SSE2-153]
_ = x[SSE3-154]
_ = x[SSE4-155]
_ = x[SSE42-156]
_ = x[SSE4A-157]
_ = x[SSSE3-158]
_ = x[STIBP-159]
_ = x[STIBP_ALWAYSON-160]
_ = x[STOSB_SHORT-161]
_ = x[SUCCOR-162]
_ = x[SVM-163]
_ = x[SVMDA-164]
_ = x[SVMFBASID-165]
_ = x[SVML-166]
_ = x[SVMNP-167]
_ = x[SVMPF-168]
_ = x[SVMPFT-169]
_ = x[SYSCALL-170]
_ = x[SYSEE-171]
_ = x[TBM-172]
_ = x[TDX_GUEST-173]
_ = x[TLB_FLUSH_NESTED-174]
_ = x[TME-175]
_ = x[TOPEXT-176]
_ = x[TSCRATEMSR-177]
_ = x[TSXLDTRK-178]
_ = x[VAES-179]
_ = x[VMCBCLEAN-180]
_ = x[VMPL-181]
_ = x[VMSA_REGPROT-182]
_ = x[VMX-183]
_ = x[VPCLMULQDQ-184]
_ = x[VTE-185]
_ = x[WAITPKG-186]
_ = x[WBNOINVD-187]
_ = x[WRMSRNS-188]
_ = x[X87-189]
_ = x[XGETBV1-190]
_ = x[XOP-191]
_ = x[XSAVE-192]
_ = x[XSAVEC-193]
_ = x[XSAVEOPT-194]
_ = x[XSAVES-195]
_ = x[AESARM-196]
_ = x[ARMCPUID-197]
_ = x[ASIMD-198]
_ = x[ASIMDDP-199]
_ = x[ASIMDHP-200]
_ = x[ASIMDRDM-201]
_ = x[ATOMICS-202]
_ = x[CRC32-203]
_ = x[DCPOP-204]
_ = x[EVTSTRM-205]
_ = x[FCMA-206]
_ = x[FP-207]
_ = x[FPHP-208]
_ = x[GPA-209]
_ = x[JSCVT-210]
_ = x[LRCPC-211]
_ = x[PMULL-212]
_ = x[SHA1-213]
_ = x[SHA2-214]
_ = x[SHA3-215]
_ = x[SHA512-216]
_ = x[SM3-217]
_ = x[SM4-218]
_ = x[SVE-219]
_ = x[lastID-220]
_ = x[firstID-0]
}
const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXFP8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 61, 68, 73, 76, 81, 90, 99, 108, 112, 122, 134, 142, 150, 158, 166, 173, 183, 193, 201, 211, 222, 230, 240, 258, 273, 280, 292, 299, 306, 317, 329, 337, 341, 345, 351, 356, 364, 369, 375, 379, 388, 406, 414, 421, 425, 429, 443, 449, 453, 457, 466, 470, 474, 479, 484, 488, 492, 499, 503, 506, 512, 515, 518, 528, 538, 551, 564, 568, 579, 583, 597, 614, 617, 627, 638, 644, 652, 663, 671, 683, 699, 713, 724, 734, 749, 757, 768, 778, 785, 794, 804, 808, 811, 818, 823, 834, 841, 848, 856, 859, 865, 870, 879, 886, 894, 898, 901, 907, 914, 927, 932, 934, 941, 948, 954, 958, 967, 971, 976, 982, 988, 994, 1004, 1007, 1023, 1027, 1036, 1039, 1048, 1063, 1076, 1082, 1096, 1103, 1106, 1111, 1114, 1117, 1129, 1143, 1153, 1165, 1172, 1191, 1194, 1198, 1202, 1206, 1211, 1216, 1221, 1226, 1240, 1251, 1257, 1260, 1265, 1274, 1278, 1283, 1288, 1294, 1301, 1306, 1309, 1318, 1334, 1337, 1343, 1353, 1361, 1365, 1374, 1378, 1390, 1393, 1403, 1406, 1413, 1421, 1428, 1431, 1438, 1441, 1446, 1452, 1460, 1466, 1472, 1480, 1485, 1492, 1499, 1507, 1514, 1519, 1524, 1531, 1535, 1537, 1541, 1544, 1549, 1554, 1559, 1563, 1567, 1571, 1577, 1580, 1583, 1586, 1592}
func (i FeatureID) String() string {
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {
return "FeatureID(" + strconv.FormatInt(int64(i), 10) + ")"
}
return _FeatureID_name[_FeatureID_index[i]:_FeatureID_index[i+1]]
}
func _() {
// An "invalid array index" compiler error signifies that the constant values have changed.
// Re-run the stringer command to generate them again.
var x [1]struct{}
_ = x[VendorUnknown-0]
_ = x[Intel-1]
_ = x[AMD-2]
_ = x[VIA-3]
_ = x[Transmeta-4]
_ = x[NSC-5]
_ = x[KVM-6]
_ = x[MSVM-7]
_ = x[VMware-8]
_ = x[XenHVM-9]
_ = x[Bhyve-10]
_ = x[Hygon-11]
_ = x[SiS-12]
_ = x[RDC-13]
_ = x[Ampere-14]
_ = x[ARM-15]
_ = x[Broadcom-16]
_ = x[Cavium-17]
_ = x[DEC-18]
_ = x[Fujitsu-19]
_ = x[Infineon-20]
_ = x[Motorola-21]
_ = x[NVIDIA-22]
_ = x[AMCC-23]
_ = x[Qualcomm-24]
_ = x[Marvell-25]
_ = x[QEMU-26]
_ = x[QNX-27]
_ = x[ACRN-28]
_ = x[SRE-29]
_ = x[Apple-30]
_ = x[lastVendor-31]
}
const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvellQEMUQNXACRNSREApplelastVendor"
var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 149, 152, 156, 159, 164, 174}
func (i Vendor) String() string {
if i < 0 || i >= Vendor(len(_Vendor_index)-1) {
return "Vendor(" + strconv.FormatInt(int64(i), 10) + ")"
}
return _Vendor_name[_Vendor_index[i]:_Vendor_index[i+1]]
}
+121
View File
@@ -0,0 +1,121 @@
// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
package cpuid
import (
"runtime"
"strings"
"golang.org/x/sys/unix"
)
func detectOS(c *CPUInfo) bool {
if runtime.GOOS != "ios" {
tryToFillCPUInfoFomSysctl(c)
}
// There are no hw.optional sysctl values for the below features on Mac OS 11.0
// to detect their supported state dynamically. Assume the CPU features that
// Apple Silicon M1 supports to be available as a minimal set of features
// to all Go programs running on darwin/arm64.
// TODO: Add more if we know them.
c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2)
return true
}
func sysctlGetBool(name string) bool {
value, err := unix.SysctlUint32(name)
if err != nil {
return false
}
return value != 0
}
func sysctlGetString(name string) string {
value, err := unix.Sysctl(name)
if err != nil {
return ""
}
return value
}
func sysctlGetInt(unknown int, names ...string) int {
for _, name := range names {
value, err := unix.SysctlUint32(name)
if err != nil {
continue
}
if value != 0 {
return int(value)
}
}
return unknown
}
func sysctlGetInt64(unknown int, names ...string) int {
for _, name := range names {
value64, err := unix.SysctlUint64(name)
if err != nil {
continue
}
if int(value64) != unknown {
return int(value64)
}
}
return unknown
}
func setFeature(c *CPUInfo, name string, feature FeatureID) {
c.featureSet.setIf(sysctlGetBool(name), feature)
}
func tryToFillCPUInfoFomSysctl(c *CPUInfo) {
c.BrandName = sysctlGetString("machdep.cpu.brand_string")
if len(c.BrandName) != 0 {
c.VendorString = strings.Fields(c.BrandName)[0]
}
c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu")
c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") /
sysctlGetInt(1, "hw.physicalcpu")
c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count")
c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily")
c.Model = sysctlGetInt(0, "machdep.cpu.model")
c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize")
c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize")
c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize")
c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize")
c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize")
// from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile
setFeature(c, "hw.optional.arm.FEAT_AES", AESARM)
setFeature(c, "hw.optional.AdvSIMD", ASIMD)
setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP)
setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM)
setFeature(c, "hw.optional.FEAT_CRC32", CRC32)
setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP)
// setFeature(c, "", EVTSTRM)
setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA)
setFeature(c, "hw.optional.arm.FEAT_FP", FP)
setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP)
setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA)
setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT)
setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC)
setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL)
setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1)
setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2)
setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3)
setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512)
// setFeature(c, "", SM3)
// setFeature(c, "", SM4)
setFeature(c, "hw.optional.arm.FEAT_SVE", SVE)
// from empirical observation
setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP)
setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS)
setFeature(c, "hw.optional.floatingpoint", FP)
setFeature(c, "hw.optional.armv8_2_sha3", SHA3)
setFeature(c, "hw.optional.armv8_2_sha512", SHA512)
setFeature(c, "hw.optional.armv8_3_compnum", FCMA)
setFeature(c, "hw.optional.armv8_crc32", CRC32)
}
+130
View File
@@ -0,0 +1,130 @@
// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
// Copyright 2018 The Go Authors. All rights reserved.
// Use of this source code is governed by a BSD-style
// license that can be found in the LICENSE file located
// here https://github.com/golang/sys/blob/master/LICENSE
package cpuid
import (
"encoding/binary"
"io/ioutil"
"runtime"
)
// HWCAP bits.
const (
hwcap_FP = 1 << 0
hwcap_ASIMD = 1 << 1
hwcap_EVTSTRM = 1 << 2
hwcap_AES = 1 << 3
hwcap_PMULL = 1 << 4
hwcap_SHA1 = 1 << 5
hwcap_SHA2 = 1 << 6
hwcap_CRC32 = 1 << 7
hwcap_ATOMICS = 1 << 8
hwcap_FPHP = 1 << 9
hwcap_ASIMDHP = 1 << 10
hwcap_CPUID = 1 << 11
hwcap_ASIMDRDM = 1 << 12
hwcap_JSCVT = 1 << 13
hwcap_FCMA = 1 << 14
hwcap_LRCPC = 1 << 15
hwcap_DCPOP = 1 << 16
hwcap_SHA3 = 1 << 17
hwcap_SM3 = 1 << 18
hwcap_SM4 = 1 << 19
hwcap_ASIMDDP = 1 << 20
hwcap_SHA512 = 1 << 21
hwcap_SVE = 1 << 22
hwcap_ASIMDFHM = 1 << 23
)
func detectOS(c *CPUInfo) bool {
// For now assuming no hyperthreading is reasonable.
c.LogicalCores = runtime.NumCPU()
c.PhysicalCores = c.LogicalCores
c.ThreadsPerCore = 1
if hwcap == 0 {
// We did not get values from the runtime.
// Try reading /proc/self/auxv
// From https://github.com/golang/sys
const (
_AT_HWCAP = 16
_AT_HWCAP2 = 26
uintSize = int(32 << (^uint(0) >> 63))
)
buf, err := ioutil.ReadFile("/proc/self/auxv")
if err != nil {
// e.g. on android /proc/self/auxv is not accessible, so silently
// ignore the error and leave Initialized = false. On some
// architectures (e.g. arm64) doinit() implements a fallback
// readout and will set Initialized = true again.
return false
}
bo := binary.LittleEndian
for len(buf) >= 2*(uintSize/8) {
var tag, val uint
switch uintSize {
case 32:
tag = uint(bo.Uint32(buf[0:]))
val = uint(bo.Uint32(buf[4:]))
buf = buf[8:]
case 64:
tag = uint(bo.Uint64(buf[0:]))
val = uint(bo.Uint64(buf[8:]))
buf = buf[16:]
}
switch tag {
case _AT_HWCAP:
hwcap = val
case _AT_HWCAP2:
// Not used
}
}
if hwcap == 0 {
return false
}
}
// HWCap was populated by the runtime from the auxiliary vector.
// Use HWCap information since reading aarch64 system registers
// is not supported in user space on older linux kernels.
c.featureSet.setIf(isSet(hwcap, hwcap_AES), AESARM)
c.featureSet.setIf(isSet(hwcap, hwcap_ASIMD), ASIMD)
c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDDP), ASIMDDP)
c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDHP), ASIMDHP)
c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDRDM), ASIMDRDM)
c.featureSet.setIf(isSet(hwcap, hwcap_CPUID), ARMCPUID)
c.featureSet.setIf(isSet(hwcap, hwcap_CRC32), CRC32)
c.featureSet.setIf(isSet(hwcap, hwcap_DCPOP), DCPOP)
c.featureSet.setIf(isSet(hwcap, hwcap_EVTSTRM), EVTSTRM)
c.featureSet.setIf(isSet(hwcap, hwcap_FCMA), FCMA)
c.featureSet.setIf(isSet(hwcap, hwcap_FP), FP)
c.featureSet.setIf(isSet(hwcap, hwcap_FPHP), FPHP)
c.featureSet.setIf(isSet(hwcap, hwcap_JSCVT), JSCVT)
c.featureSet.setIf(isSet(hwcap, hwcap_LRCPC), LRCPC)
c.featureSet.setIf(isSet(hwcap, hwcap_PMULL), PMULL)
c.featureSet.setIf(isSet(hwcap, hwcap_SHA1), SHA1)
c.featureSet.setIf(isSet(hwcap, hwcap_SHA2), SHA2)
c.featureSet.setIf(isSet(hwcap, hwcap_SHA3), SHA3)
c.featureSet.setIf(isSet(hwcap, hwcap_SHA512), SHA512)
c.featureSet.setIf(isSet(hwcap, hwcap_SM3), SM3)
c.featureSet.setIf(isSet(hwcap, hwcap_SM4), SM4)
c.featureSet.setIf(isSet(hwcap, hwcap_SVE), SVE)
// The Samsung S9+ kernel reports support for atomics, but not all cores
// actually support them, resulting in SIGILL. See issue #28431.
// TODO(elias.naur): Only disable the optimization on bad chipsets on android.
c.featureSet.setIf(isSet(hwcap, hwcap_ATOMICS) && runtime.GOOS != "android", ATOMICS)
return true
}
func isSet(hwc uint, value uint) bool {
return hwc&value != 0
}
+16
View File
@@ -0,0 +1,16 @@
// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file.
//go:build arm64 && !linux && !darwin
// +build arm64,!linux,!darwin
package cpuid
import "runtime"
func detectOS(c *CPUInfo) bool {
c.PhysicalCores = runtime.NumCPU()
// For now assuming 1 thread per core...
c.ThreadsPerCore = 1
c.LogicalCores = c.PhysicalCores
return false
}
@@ -0,0 +1,8 @@
// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
//go:build nounsafe
// +build nounsafe
package cpuid
var hwcap uint
@@ -0,0 +1,11 @@
// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file.
//go:build !nounsafe
// +build !nounsafe
package cpuid
import _ "unsafe" // needed for go:linkname
//go:linkname hwcap internal/cpu.HWCap
var hwcap uint
@@ -0,0 +1,15 @@
#!/bin/sh
set -e
go tool dist list | while IFS=/ read os arch; do
echo "Checking $os/$arch..."
echo " normal"
GOARCH=$arch GOOS=$os go build -o /dev/null .
echo " noasm"
GOARCH=$arch GOOS=$os go build -tags noasm -o /dev/null .
echo " appengine"
GOARCH=$arch GOOS=$os go build -tags appengine -o /dev/null .
echo " noasm,appengine"
GOARCH=$arch GOOS=$os go build -tags 'appengine noasm' -o /dev/null .
done